![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
![]() | Protein NK cell ligand RAE-1 beta [69683] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [69684] (3 PDB entries) |
![]() | Domain d1jfmd_: 1jfm D: [66643] |
PDB Entry: 1jfm (more details), 2.85 Å
SCOPe Domain Sequences for d1jfmd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfmd_ d.19.1.1 (D:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]} dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
Timeline for d1jfmd_:
![]() Domains from other chains: (mouse over for more information) d1jfma_, d1jfmb_, d1jfmc_, d1jfme_ |