Lineage for d1jfmc_ (1jfm C:)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 131823Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
  4. 131824Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) (S)
  5. 131825Family d.19.1.1: MHC antigen-recognition domain [54453] (9 proteins)
  6. 132088Protein NK cell ligand RAE-1 beta [69683] (1 species)
  7. 132089Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries)
  8. 132092Domain d1jfmc_: 1jfm C: [66642]

Details for d1jfmc_

PDB Entry: 1jfm (more details), 2.85 Å

PDB Description: crystal structure of murine nk cell ligand rae-1 beta

SCOP Domain Sequences for d1jfmc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfmc_ d.19.1.1 (C:) NK cell ligand RAE-1 beta {Mouse (Mus musculus)}
dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc
ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff
tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek

SCOP Domain Coordinates for d1jfmc_:

Click to download the PDB-style file with coordinates for d1jfmc_.
(The format of our PDB-style files is described here.)

Timeline for d1jfmc_: