Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein NK cell ligand RAE-1 beta [69683] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [69684] (2 PDB entries) |
Domain d1jfma_: 1jfm A: [66640] |
PDB Entry: 1jfm (more details), 2.85 Å
SCOPe Domain Sequences for d1jfma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfma_ d.19.1.1 (A:) NK cell ligand RAE-1 beta {Mouse (Mus musculus) [TaxId: 10090]} dahslrcnltikdptpadplwyeakcfvgeililhlsninktmtsgdpgetanatevkkc ltqplknlcqklrnkvsntkvdthktngyphlqvtmiypqsqgrtpsatwefnisdsyff tfytenmswrsandesgvimnkwkddgefvkqlkflihecsqkmdeflkqskek
Timeline for d1jfma_:
View in 3D Domains from other chains: (mouse over for more information) d1jfmb_, d1jfmc_, d1jfmd_, d1jfme_ |