Lineage for d1jfka_ (1jfk A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
    Duplication: made with two pairs of EF-hands
  6. Protein EHCABP [69021] (1 species)
  7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (3 PDB entries)
  8. Domain d1jfka_: 1jfk A: [66639]
    complexed with ca

Details for d1jfka_

PDB Entry: 1jfk (more details)

PDB Description: minimum energy representative structure of a calcium bound ef-hand protein from entamoeba histolytica
PDB Compounds: (A:) calcium-binding protein

SCOPe Domain Sequences for d1jfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfka_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
dgyitleeflefsl

SCOPe Domain Coordinates for d1jfka_ are not available.

Timeline for d1jfka_: