SCOPe 2.07: Domain d1jfja_: 1jfj A:

Lineage for d1jfja_ (1jfj A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein EHCABP [69021] (1 species)

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [69022] (3 PDB entries)

8. Domain d1jfja_: 1jfj A: [66638]

Details for d1jfja_

PDB Entry: 1jfj

PDB Description: nmr solution structure of an ef-hand calcium binding protein from entamoeba histolytica

PDB Compounds: (A:) calcium-binding protein

SCOPe Domain Sequences for d1jfja_:

Sequence; same for both SEQRES and ATOM records:

>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maealfkeidvngdgavsyeevkafvskkraikneqllqlifksidadgngeidqnefak
fygsiqgqdlsddkiglkvlyklmdvdgdgkltkeevtsffkkhgiekvaeqvmkadang
dgyitleeflefsl

Timeline for d1jfja_:

• d1jfja_ first appeared in SCOP 1.59
  
• d1jfja_ appears in SCOPe 2.06
  
• d1jfja_ appears in the current release, SCOPe 2.08