Lineage for d1jfef1 (1jfe F:142-393)

  1. Root: SCOP 1.59
  2. 128814Class d: Alpha and beta proteins (a+b) [53931] (208 folds)
  3. 139662Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily)
  4. 139663Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) (S)
  5. 139664Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins)
  6. 139665Protein Fibrinogen C-terminal domains [56498] (5 species)
  7. 139669Species Chicken (Gallus gallus), gamma [TaxId:9031] [69859] (1 PDB entry)
  8. 139671Domain d1jfef1: 1jfe F:142-393 [66634]
    Other proteins in same PDB: d1jfea1, d1jfeb2, d1jfec2, d1jfed1, d1jfee2, d1jfef2

Details for d1jfef1

PDB Entry: 1jfe (more details), 2.7 Å

PDB Description: Crystal structure of native chicken fibrinogen with two different bound ligands

SCOP Domain Sequences for d1jfef1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfef1 d.171.1.1 (F:142-393) Fibrinogen C-terminal domains {Chicken (Gallus gallus), gamma}
taeiqettgrdcqdiankgarksglyfikpqkakqsflvyceidtygngwtvlqrrldgs
edfrrnwvqykegfghlspddttefwlgnekihlittqstlpyalrieledwsgkkgtad
yavfkvgteedkyrltyayfiggeagdafdgfnfgddpsdksytyhngmrfstfdndndn
fegncaeqdgsgwwmnrchaghlngpyyiggvysrdtgtnsydngiiwatwrdrwysmkk
ttmkiipfnrls

SCOP Domain Coordinates for d1jfef1:

Click to download the PDB-style file with coordinates for d1jfef1.
(The format of our PDB-style files is described here.)

Timeline for d1jfef1:

  • d1jfef1 is new in SCOP 1.59
  • d1jfef1 became obsolete in SCOP 1.61