Lineage for d1jfeb1 (1jfe B:200-464)
- Root: SCOP 1.59
Class d: Alpha and beta proteins (a+b) [53931] (208 folds) 
Fold d.171: Fibrinogen C-terminal domain-like [56495] (1 superfamily) Superfamily d.171.1: Fibrinogen C-terminal domain-like [56496] (1 family) 
Family d.171.1.1: Fibrinogen C-terminal domain-like [56497] (2 proteins) Protein Fibrinogen C-terminal domains [56498] (5 species) 
Species Chicken (Gallus gallus), beta [TaxId:9031] [69860] (1 PDB entry) 
Domain d1jfeb1: 1jfe B:200-464 [66627]
Other proteins in same PDB: d1jfea1, d1jfeb2, d1jfec2, d1jfed1, d1jfee2, d1jfef2
Details for d1jfeb1
PDB Entry: 1jfe (more details), 2.7 Å
PDB Description: Crystal structure of native chicken fibrinogen with two different bound ligands
SCOP Domain Sequences for d1jfeb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfeb1 d.171.1.1 (B:200-464) Fibrinogen C-terminal domains {Chicken (Gallus gallus), beta}
spcvascnipvvsgrecediyrkggetsemyiiqpdpfttpyrvycdmetdnggwtliqn
rqdgsvnfgrawdeykrgfgniaksggkkycdtpgeywlgndkisqltkigptkvlieme
dwngdkvsalyggftihnegnkyqlsvsnykgnagnalmegasqlygenrtmtihngmyf
stydrdndgwlttdprkqcskedgggwwynrchaanpngryywggtyswdmakhgtddgi
vwmnwkgswysmkkmsmkikpyfpd
SCOP Domain Coordinates for d1jfeb1:
Click to download the PDB-style file with coordinates for d1jfeb1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfeb1:
- d1jfeb1 is new in SCOP 1.59
- d1jfeb1 does not appear in SCOP 1.61
View in 3D
