Lineage for d1jfea1 (1jfe A:)

  1. Root: SCOP 1.59
  2. 145365Class h: Coiled coil proteins [57942] (5 folds)
  3. 145366Fold h.1: Parallel coiled-coil [57943] (21 superfamilies)
  4. 145692Superfamily h.1.8: Fibrinogen coiled-coil and central regions [58010] (1 family) (S)
  5. 145693Family h.1.8.1: Fibrinogen coiled-coil and central regions [58011] (1 protein)
  6. 145694Protein Fibrinogen coiled-coil and central regions [58012] (3 species)
  7. 145695Species Chicken (Gallus gallus) [TaxId:9031] [69976] (1 PDB entry)
  8. 145696Domain d1jfea1: 1jfe A: [66626]
    Other proteins in same PDB: d1jfeb1, d1jfec1, d1jfee1, d1jfef1

Details for d1jfea1

PDB Entry: 1jfe (more details), 2.7 Å

PDB Description: Crystal structure of native chicken fibrinogen with two different bound ligands

SCOP Domain Sequences for d1jfea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfea1 h.1.8.1 (A:) Fibrinogen coiled-coil and central regions {Chicken (Gallus gallus)}
ckyeknwpicvdddwgtkcpsgcrmqgiiddtdqnysqridnirqqladsqnkyktsnrv
ivetinilkpglegaqqldenyghvstelrrrivtlkqrvatqvnrikalqnsiqeqvve
mkrlevdidikirackgscarsfdyqvdkegydniqkhltqassidmhpdfqtttlstlk
mrplkdsnvpe

SCOP Domain Coordinates for d1jfea1:

Click to download the PDB-style file with coordinates for d1jfea1.
(The format of our PDB-style files is described here.)

Timeline for d1jfea1:

  • d1jfea1 is new in SCOP 1.59
  • d1jfea1 became obsolete in SCOP 1.61