SCOP 1.63: Domain d1jeea3: 1jee A:390-511

Lineage for d1jeea3 (1jee A:390-511)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)

6. Protein ATP sulfurylase C-terminal domain [64012] (2 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (6 PDB entries)

8. Domain d1jeea3: 1jee A:390-511 [66606]
   Other proteins in same PDB: d1jeea1, d1jeea2, d1jeeb1, d1jeeb2

Details for d1jeea3

PDB Entry: 1jee, 2.8 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with chlorate

SCOP Domain Sequences for d1jeea3:

Sequence; same for both SEQRES and ATOM records:

>d1jeea3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipnqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf

Timeline for d1jeea3:

• d1jeea3 first appeared in SCOP 1.59
  
• d1jeea3 appears in SCOP 1.61
  
• d1jeea3 appears in SCOP 1.65
  
• d1jeea3 appears in the current release, SCOPe 2.08