Lineage for d1jeea2 (1jee A:169-389)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 178484Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
  4. 178485Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 178615Family c.26.1.5: ATP sulfurylase central domain [63979] (1 protein)
  6. 178616Protein ATP sulfurylase central domain [63980] (3 species)
  7. 178617Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63981] (6 PDB entries)
  8. 178622Domain d1jeea2: 1jee A:169-389 [66605]
    Other proteins in same PDB: d1jeea1, d1jeea3, d1jeeb1, d1jeeb3

Details for d1jeea2

PDB Entry: 1jee (more details), 2.8 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with chlorate

SCOP Domain Sequences for d1jeea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeea2 c.26.1.5 (A:169-389) ATP sulfurylase central domain {Baker's yeast (Saccharomyces cerevisiae)}
ypglrktpaqlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvglt
kpgdidhhtrvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfiv
grdhagpgknskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidt
tktrtlnisgtelrrrlrvggeipewfsypevvkilresnp

SCOP Domain Coordinates for d1jeea2:

Click to download the PDB-style file with coordinates for d1jeea2.
(The format of our PDB-style files is described here.)

Timeline for d1jeea2: