SCOP 1.63: Domain d1jeea1: 1jee A:2-168

Lineage for d1jeea1 (1jee A:2-168)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
   incomplete barrel of 6 strands, the last PK strand is missing

6. Protein ATP sulfurylase N-terminal domain [63802] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (6 PDB entries)

8. Domain d1jeea1: 1jee A:2-168 [66604]
   Other proteins in same PDB: d1jeea2, d1jeea3, d1jeeb2, d1jeeb3

Details for d1jeea1

PDB Entry: 1jee, 2.8 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with chlorate

SCOP Domain Sequences for d1jeea1:

Sequence; same for both SEQRES and ATOM records:

>d1jeea1 b.58.1.2 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1jeea1:

• d1jeea1 first appeared in SCOP 1.59
  
• d1jeea1 appears in SCOP 1.61
  
• d1jeea1 appears in SCOP 1.65
  
• d1jeea1 appears in the current release, SCOPe 2.08