SCOP 1.63: Domain d1jedb1: 1jed B:2-168

Lineage for d1jedb1 (1jed B:2-168)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
   barrel, closed; n=7, S=10; complex topology

4. Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families)

5. Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
   incomplete barrel of 6 strands, the last PK strand is missing

6. Protein ATP sulfurylase N-terminal domain [63802] (3 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (6 PDB entries)

8. Domain d1jedb1: 1jed B:2-168 [66601]
   Other proteins in same PDB: d1jeda2, d1jeda3, d1jedb2, d1jedb3
   complexed with acy, adp, ca, cd, mg, na, trs

Details for d1jedb1

PDB Entry: 1jed, 2.95 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with ADP

SCOP Domain Sequences for d1jedb1:

Sequence; same for both SEQRES and ATOM records:

>d1jedb1 b.58.1.2 (B:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

Timeline for d1jedb1:

• d1jedb1 first appeared in SCOP 1.59
  
• d1jedb1 appears in SCOP 1.61
  
• d1jedb1 appears in SCOP 1.65
  
• d1jedb1 appears in the current release, SCOPe 2.07