Lineage for d1jeda1 (1jed A:2-168)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 304923Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 304924Superfamily b.122.1: PUA domain-like [88697] (3 families) (S)
  5. 304944Family b.122.1.3: ATP sulfurylase N-terminal domain [63801] (1 protein)
    contains extra structures; some similarity to the PK beta-barrel domain
  6. 304945Protein ATP sulfurylase N-terminal domain [63802] (3 species)
  7. 304946Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (7 PDB entries)
  8. 304958Domain d1jeda1: 1jed A:2-168 [66598]
    Other proteins in same PDB: d1jeda2, d1jeda3, d1jedb2, d1jedb3

Details for d1jeda1

PDB Entry: 1jed (more details), 2.95 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with ADP

SCOP Domain Sequences for d1jeda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeda1 b.122.1.3 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1jeda1:

Click to download the PDB-style file with coordinates for d1jeda1.
(The format of our PDB-style files is described here.)

Timeline for d1jeda1: