![]() | Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
![]() | Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (20 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein) |
![]() | Protein ATP sulfurylase C-terminal domain [64012] (2 species) |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (6 PDB entries) |
![]() | Domain d1jeca3: 1jec A:390-511 [66597] Other proteins in same PDB: d1jeca1, d1jeca2 complexed with acy, ca, cd, mg, na, so4, thj |
PDB Entry: 1jec (more details), 2.5 Å
SCOP Domain Sequences for d1jeca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jeca3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)} prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs gsgliipnqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff vf
Timeline for d1jeca3: