Lineage for d1jeca3 (1jec A:390-511)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 179162Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 179163Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (18 families) (S)
  5. 180345Family c.37.1.15: ATP sulfurylase C-terminal domain [64011] (1 protein)
  6. 180346Protein ATP sulfurylase C-terminal domain [64012] (2 species)
  7. 180347Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [64013] (6 PDB entries)
  8. 180349Domain d1jeca3: 1jec A:390-511 [66597]
    Other proteins in same PDB: d1jeca1, d1jeca2

Details for d1jeca3

PDB Entry: 1jec (more details), 2.5 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with thiosulfate

SCOP Domain Sequences for d1jeca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeca3 c.37.1.15 (A:390-511) ATP sulfurylase C-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
prpkqgfsivlgnsltvsreqlsiallstflqfgggryykifehnnktellsliqdfigs
gsgliipnqweddkdsvvgkqnvylldtsssadiqlesadepishivqkvvlfledngff
vf

SCOP Domain Coordinates for d1jeca3:

Click to download the PDB-style file with coordinates for d1jeca3.
(The format of our PDB-style files is described here.)

Timeline for d1jeca3: