Lineage for d1jeca1 (1jec A:2-168)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 113337Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
  4. 113338Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 113412Family b.58.1.2: ATP sulfurylase N-terminal domain [63801] (1 protein)
  6. 113413Protein ATP sulfurylase N-terminal domain [63802] (3 species)
  7. 113414Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [63803] (6 PDB entries)
  8. 113416Domain d1jeca1: 1jec A:2-168 [66595]
    Other proteins in same PDB: d1jeca2, d1jeca3

Details for d1jeca1

PDB Entry: 1jec (more details), 2.5 Å

PDB Description: Crystal Structure of ATP Sulfurylase in complex with thiosulfate

SCOP Domain Sequences for d1jeca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jeca1 b.58.1.2 (A:2-168) ATP sulfurylase N-terminal domain {Baker's yeast (Saccharomyces cerevisiae)}
paphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfln
endyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdvy
kpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhyd

SCOP Domain Coordinates for d1jeca1:

Click to download the PDB-style file with coordinates for d1jeca1.
(The format of our PDB-style files is described here.)

Timeline for d1jeca1: