Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.1: Globin-like [46458] (5 families) |
Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
Protein Hemoglobin, beta-chain [46500] (26 species) |
Species Mouse (Mus musculus) [TaxId:10090] [68939] (1 PDB entry) |
Domain d1jebd_: 1jeb D: [66594] Other proteins in same PDB: d1jeba_, d1jebc_ complexed with cmo, hem |
PDB Entry: 1jeb (more details), 2.1 Å
SCOPe Domain Sequences for d1jebd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jebd_ a.1.1.2 (D:) Hemoglobin, beta-chain {Mouse (Mus musculus) [TaxId: 10090]} vhltdaekaavsglwgkvnadevggealgrllvvypwtqryfdsfgdlssasaimgnakv kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk dftpaaqaafqkvvagvaaalahkyh
Timeline for d1jebd_: