SCOPe 2.03: Domain d1jebb_: 1jeb B:

Lineage for d1jebb_ (1jeb B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (24 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [68939] (1 PDB entry)

8. Domain d1jebb_: 1jeb B: [66592]
   Other proteins in same PDB: d1jeba_, d1jebc_
   complexed with cmo, hem

Details for d1jebb_

PDB Entry: 1jeb, 2.1 Å

PDB Description: Chimeric Human/Mouse Carbonmonoxy Hemoglobin (Human Zeta2 / Mouse Beta2)

PDB Compounds: (B:) hemoglobin beta-single chain

SCOPe Domain Sequences for d1jebb_:

Sequence; same for both SEQRES and ATOM records:

>d1jebb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Mouse (Mus musculus) [TaxId: 10090]}
vhltdaekaavsglwgkvnadevggealgrllvvypwtqryfdsfgdlssasaimgnakv
kahgkkvitafndglnhldslkgtfaslselhcdklhvdpenfrllgnmivivlghhlgk
dftpaaqaafqkvvagvaaalah

Timeline for d1jebb_:

• d1jebb_ first appeared in SCOP 1.59
  
• d1jebb_ appears in SCOPe 2.02
  
• d1jebb_ appears in SCOPe 2.04
  
• d1jebb_ appears in the current release, SCOPe 2.08