Lineage for d1jdea3 (1jde A:2-376)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734347Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 734348Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (8 families) (S)
  5. 734548Family d.142.1.5: Pyruvate phosphate dikinase, N-terminal domain [56085] (1 protein)
  6. 734549Protein Pyruvate phosphate dikinase, N-terminal domain [56086] (3 species)
    the common fold is interrupted by a 4-helical subdomain (residues 112-198)
  7. 734550Species Clostridium symbiosum [TaxId:1512] [56087] (6 PDB entries)
  8. 734556Domain d1jdea3: 1jde A:2-376 [66548]
    Other proteins in same PDB: d1jdea1, d1jdea2
    complexed with so4; mutant

Details for d1jdea3

PDB Entry: 1jde (more details), 2.8 Å

PDB Description: k22a mutant of pyruvate, phosphate dikinase
PDB Compounds: (A:) Pyruvate, phosphate dikinase

SCOP Domain Sequences for d1jdea3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdea3 d.142.1.5 (A:2-376) Pyruvate phosphate dikinase, N-terminal domain {Clostridium symbiosum [TaxId: 1512]}
akwvykfeegnasmrnllggagcnlaemtilgmpipqgftvtteacteyynsgkqitqei
qdqifeaitwleelngkkfgdtedpllvsvrsgarasmpgmmdtilnlglndvavegfak
ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
ykqfmdlamklekhfrdmqdmeftieegklyflqtrngkrtapaalqiacdlvdegmite
eeavvrieaksldql

SCOP Domain Coordinates for d1jdea3:

Click to download the PDB-style file with coordinates for d1jdea3.
(The format of our PDB-style files is described here.)

Timeline for d1jdea3: