Lineage for d1jdea1 (1jde A:510-874)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 570217Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 573147Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 573238Family c.1.12.2: Pyruvate phosphate dikinase, C-terminal domain [51629] (1 protein)
  6. 573239Protein Pyruvate phosphate dikinase, C-terminal domain [51630] (2 species)
  7. 573240Species Clostridium symbiosum [TaxId:1512] [51631] (6 PDB entries)
  8. 573246Domain d1jdea1: 1jde A:510-874 [66546]
    Other proteins in same PDB: d1jdea2, d1jdea3
    complexed with so4; mutant

Details for d1jdea1

PDB Entry: 1jde (more details), 2.8 Å

PDB Description: k22a mutant of pyruvate, phosphate dikinase

SCOP Domain Sequences for d1jdea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jdea1 c.1.12.2 (A:510-874) Pyruvate phosphate dikinase, C-terminal domain {Clostridium symbiosum}
ietqeasvsgsferimvwadkfrtlkvrtnadtpedtlnavklgaegiglcrtehmffea
drimkirkmilsdsveareealnelipfqkgdfkamykalegrpmtvryldpplhefvph
teeeqaelaknmgltlaevkakvdelhefnpmmghrgcrlavtypeiakmqtravmeaai
evkeetgidivpeimiplvgekkelkfvkdvvvevaeqvkkekgsdmqyhigtmieipra
altadaiaeeaeffsfgtndltqmtfgfsrddagkfldsyykakiyesdpfarldqtgvg
qlvemavkkgrqtrpglkcgicgehggdpssvefchkvglnyvscspfrvpiarlaaaqa
alnnk

SCOP Domain Coordinates for d1jdea1:

Click to download the PDB-style file with coordinates for d1jdea1.
(The format of our PDB-style files is described here.)

Timeline for d1jdea1: