Lineage for d1jd22_ (1jd2 2:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 419895Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 419896Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 420035Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 420238Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 420262Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (4 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 420306Domain d1jd22_: 1jd2 2: [66515]
    Other proteins in same PDB: d1jd2a_, d1jd2b_, d1jd2c_, d1jd2d_, d1jd2e_, d1jd2f_, d1jd2g_, d1jd2o_, d1jd2p_, d1jd2q_, d1jd2r_, d1jd2s_, d1jd2t_, d1jd2u_
    complexed with 95a, mg

Details for d1jd22_

PDB Entry: 1jd2 (more details), 3 Å

PDB Description: crystal structure of the yeast 20s proteasome:tmc-95a complex: a non- covalent proteasome inhibitor

SCOP Domain Sequences for d1jd22_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd22_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae)}
agydrhitifspegrlyqveyafkatnqtninslavrgkdctvvisqkkvpdklldpttv
syifcisrtigmvvngpipdarnaalrakaeaaefrykygydmpcdvlakrmanlsqiyt
qraymrplgviltfvsvdeelgpsiyktdpagyyvgykatatgpkqqeittnlenhfkks
kidhineeswekvvefaithmidalgtefskndlevgvatkdkfftlsaenieerlvaia
eqd

SCOP Domain Coordinates for d1jd22_:

Click to download the PDB-style file with coordinates for d1jd22_.
(The format of our PDB-style files is described here.)

Timeline for d1jd22_: