Lineage for d1jd21_ (1jd2 1:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1044569Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 1044570Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 1044729Family d.153.1.4: Proteasome subunits [56251] (4 proteins)
  6. 1045208Protein Proteasome beta subunit (catalytic) [56252] (5 species)
  7. 1045217Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (28 PDB entries)
    The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)
  8. 1045532Domain d1jd21_: 1jd2 1: [66514]
    Other proteins in same PDB: d1jd2a_, d1jd2b_, d1jd2c_, d1jd2d_, d1jd2e_, d1jd2f_, d1jd2g_, d1jd2o_, d1jd2p_, d1jd2q_, d1jd2r_, d1jd2s_, d1jd2t_, d1jd2u_
    complexed with mg

Details for d1jd21_

PDB Entry: 1jd2 (more details), 3 Å

PDB Description: crystal structure of the yeast 20s proteasome:tmc-95a complex: a non- covalent proteasome inhibitor
PDB Compounds: (1:) Proteasome component C1

SCOPe Domain Sequences for d1jd21_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jd21_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
gtgydlsnsvfspdgrnfqveyavkavengttsigikcndgvvfaveklitskllvpqkn
vkiqvvdrhigcvysglipdgrhlvnrgreeaasfkklyktpipipafadrlgqyvqaht
lynsvrpfgvstifggvdkngahlymlepsgsywgykgaatgkgrqsakaeleklvdhhp
eglsareavkqaakiiylahednkekdfeleiswcslsetnglhkfvkgdllqeaidfaq
kein

SCOPe Domain Coordinates for d1jd21_:

Click to download the PDB-style file with coordinates for d1jd21_.
(The format of our PDB-style files is described here.)

Timeline for d1jd21_: