![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein CD3 epsilon chain ectodomain fragment [69162] (3 species) possibly an intermediate structure between the I set and FnIII domains |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [69163] (2 PDB entries) Uniprot P22646 22-100 |
![]() | Domain d1jbja2: 1jbj A:1-100 [66483] Other proteins in same PDB: d1jbja1 a single-chain construct with gamma chain domain, includes part of the linker |
PDB Entry: 1jbj (more details)
SCOPe Domain Sequences for d1jbja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]} ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy vcytpasnkntylylkarvgsaddakkdaakkddakkdda
Timeline for d1jbja2: