Lineage for d1jbja2 (1jbj A:1-100)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518689Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1518694Species Mouse (Mus musculus) [TaxId:10090] [69163] (2 PDB entries)
    Uniprot P22646 22-100
  8. 1518695Domain d1jbja2: 1jbj A:1-100 [66483]
    Other proteins in same PDB: d1jbja1
    a single-chain construct with gamma chain domain, includes part of the linker

Details for d1jbja2

PDB Entry: 1jbj (more details)

PDB Description: cd3 epsilon and gamma ectodomain fragment complex in single-chain construct
PDB Compounds: (A:) CD3 Epsilon and gamma Ectodomain Fragment Complex

SCOPe Domain Sequences for d1jbja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}
ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
vcytpasnkntylylkarvgsaddakkdaakkddakkdda

SCOPe Domain Coordinates for d1jbja2:

Click to download the PDB-style file with coordinates for d1jbja2.
(The format of our PDB-style files is described here.)

Timeline for d1jbja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jbja1