SCOPe 2.07: Domain d1jbja2: 1jbj A:1-100

Lineage for d1jbja2 (1jbj A:1-100)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein CD3 epsilon chain ectodomain fragment [69162] (3 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Mouse (Mus musculus) [TaxId:10090] [69163] (2 PDB entries)
   Uniprot P22646 22-100

8. Domain d1jbja2: 1jbj A:1-100 [66483]
   Other proteins in same PDB: d1jbja1
   a single-chain construct with gamma chain domain, includes part of the linker

Details for d1jbja2

PDB Entry: 1jbj

PDB Description: CD3 Epsilon and gamma Ectodomain Fragment Complex in Single-Chain Construct

PDB Compounds: (A:) CD3 Epsilon and gamma Ectodomain Fragment Complex

SCOPe Domain Sequences for d1jbja2:

Sequence; same for both SEQRES and ATOM records:

>d1jbja2 b.1.1.4 (A:1-100) CD3 epsilon chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}
ddaenieykvsisgtsveltcpldsdenlkwekngqelpqkhdkhlvlqdfsevedsgyy
vcytpasnkntylylkarvgsaddakkdaakkddakkdda

Timeline for d1jbja2:

• d1jbja2 first appeared in SCOP 1.59
  
• d1jbja2 appears in SCOPe 2.06