Lineage for d1jbja1 (1jbj A:101-186)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518699Protein CD3 gamma chain ectodomain fragment [69160] (2 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1518702Species Mouse (Mus musculus) [TaxId:10090] [69161] (1 PDB entry)
  8. 1518703Domain d1jbja1: 1jbj A:101-186 [66482]
    Other proteins in same PDB: d1jbja2
    a single-chain construct with epsilon chain domain, includes part of the linker

Details for d1jbja1

PDB Entry: 1jbj (more details)

PDB Description: cd3 epsilon and gamma ectodomain fragment complex in single-chain construct
PDB Compounds: (A:) CD3 Epsilon and gamma Ectodomain Fragment Complex

SCOPe Domain Sequences for d1jbja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}
kkdgsqtnkaknlvqvdgsrgdgsvlltcgltdktikwlkdgsiisplnatkntwnlgnn
akdprgtyqcqgaketsnplqvyyrm

SCOPe Domain Coordinates for d1jbja1:

Click to download the PDB-style file with coordinates for d1jbja1.
(The format of our PDB-style files is described here.)

Timeline for d1jbja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jbja2