| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.4: I set domains [49159] (39 proteins) |
| Protein CD3 gamma chain ectodomain fragment [69160] (2 species) possibly an intermediate structure between the I set and FnIII domains |
| Species Mouse (Mus musculus) [TaxId:10090] [69161] (1 PDB entry) |
| Domain d1jbja1: 1jbj A:101-186 [66482] Other proteins in same PDB: d1jbja2 a single-chain construct with epsilon chain domain, includes part of the linker |
PDB Entry: 1jbj (more details)
SCOPe Domain Sequences for d1jbja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jbja1 b.1.1.4 (A:101-186) CD3 gamma chain ectodomain fragment {Mouse (Mus musculus) [TaxId: 10090]}
kkdgsqtnkaknlvqvdgsrgdgsvlltcgltdktikwlkdgsiisplnatkntwnlgnn
akdprgtyqcqgaketsnplqvyyrm
Timeline for d1jbja1: