Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.12: ArsC-like [69518] (4 proteins) Pfam PF03960 |
Protein Arsenate reductase ArsC [69519] (1 species) |
Species Escherichia coli [TaxId:562] [69520] (4 PDB entries) |
Domain d1j9ba_: 1j9b A: [66459] complexed with cs, so4, tas |
PDB Entry: 1j9b (more details), 1.26 Å
SCOPe Domain Sequences for d1j9ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j9ba_ c.47.1.12 (A:) Arsenate reductase ArsC {Escherichia coli [TaxId: 562]} nitiyhnpacgtsrntlemirnsgteptiilylenppsrdelvkliadmgisvrallrkn vepyeqlglaedkftddqlidfmlqhpilinrpivvtplgtrlcrpsevvldilqdaqkg aftkedgekvvdeagkrl
Timeline for d1j9ba_: