Lineage for d1j94a_ (1j94 A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 187298Protein alpha-Lactalbumin [53975] (6 species)
  7. 187330Species Mouse (Mus musculus) [TaxId:10090] [69628] (7 PDB entries)
  8. 187343Domain d1j94a_: 1j94 A: [66455]
    Other proteins in same PDB: d1j94b_, d1j94d_

Details for d1j94a_

PDB Entry: 1j94 (more details), 2.5 Å

PDB Description: crystal structure of lactose synthase, complex with udp

SCOP Domain Sequences for d1j94a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j94a_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus)}
teftkckvshaikdmdgyqgisllewacvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddiacakkivaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1j94a_:

Click to download the PDB-style file with coordinates for d1j94a_.
(The format of our PDB-style files is described here.)

Timeline for d1j94a_: