Lineage for d1j8xd_ (1j8x D:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 184079Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
  4. 184080Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (12 families) (S)
  5. 184089Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (1 protein)
  6. 184090Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 184091Species Cow (Bos taurus) [TaxId:9913] [53454] (10 PDB entries)
  8. 184097Domain d1j8xd_: 1j8x D: [66447]
    Other proteins in same PDB: d1j8xa_, d1j8xc_

Details for d1j8xd_

PDB Entry: 1j8x (more details), 2 Å

PDB Description: crystal structure of lactose synthase, complex with udp and mn

SCOP Domain Sequences for d1j8xd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8xd_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus)}
tacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrnr
qehlkywlyylhpilqrqqldygiyvinqagesmfnrakllnvgfkealkdydyncfvfs
dvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnny
wgwggedddiynrlafrgmsvsrpnavigkcrmirhsrdkknepnpqrfdriahtketml
sdglnsltymvlevqryplytkitvdigtps

SCOP Domain Coordinates for d1j8xd_:

Click to download the PDB-style file with coordinates for d1j8xd_.
(The format of our PDB-style files is described here.)

Timeline for d1j8xd_: