Lineage for d1j8xa_ (1j8x A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 187298Protein alpha-Lactalbumin [53975] (6 species)
  7. 187330Species Mouse (Mus musculus) [TaxId:10090] [69628] (7 PDB entries)
  8. 187335Domain d1j8xa_: 1j8x A: [66444]
    Other proteins in same PDB: d1j8xb_, d1j8xd_

Details for d1j8xa_

PDB Entry: 1j8x (more details), 2 Å

PDB Description: crystal structure of lactose synthase, complex with udp and mn

SCOP Domain Sequences for d1j8xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8xa_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus)}
teftkckvshaikdmdgyqgisllewtcvlfhtsgydsqavvndngsteyglfqiserfw
ckssefpesenicgiscdkllddeldddivcakkivaikgidywkaykpmcsekleqwrc
ekp

SCOP Domain Coordinates for d1j8xa_:

Click to download the PDB-style file with coordinates for d1j8xa_.
(The format of our PDB-style files is described here.)

Timeline for d1j8xa_: