SCOPe 2.06: Domain d1j8ka_: 1j8k A:

Lineage for d1j8ka_ (1j8k A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
   Pfam PF00041

6. Protein Fibronectin, different Fn3 modules [49270] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49271] (9 PDB entries)

8. Domain d1j8ka_: 1j8k A: [66439]
   ED-A domain

Details for d1j8ka_

PDB Entry: 1j8k

PDB Description: nmr structure of the fibronectin eda domain, nmr, 20 structures

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d1j8ka_:

Sequence; same for both SEQRES and ATOM records:

>d1j8ka_ b.1.2.1 (A:) Fibronectin, different Fn3 modules {Human (Homo sapiens) [TaxId: 9606]}
nidrpkglaftdvdvdsikiawespqgqvsryrvtysspedgihelfpapdgeedtaelq
glrpgseytvsvvalhddmesqpligtqstaipa

Timeline for d1j8ka_:

• d1j8ka_ first appeared in SCOP 1.59
  
• d1j8ka_ appears in SCOPe 2.05
  
• d1j8ka_ appears in SCOPe 2.07
  
• d1j8ka_ appears in the current release, SCOPe 2.08