Lineage for d1j8ea_ (1j8e A:)

  1. Root: SCOP 1.63
  2. 268577Class g: Small proteins [56992] (61 folds)
  3. 270146Fold g.12: LDL receptor-like module [57423] (1 superfamily)
  4. 270147Superfamily g.12.1: LDL receptor-like module [57424] (1 family) (S)
  5. 270148Family g.12.1.1: LDL receptor-like module [57425] (2 proteins)
  6. 270149Protein Ligand-binding domain of low-density lipoprotein receptor [57426] (1 species)
  7. 270150Species Human (Homo sapiens) [TaxId:9606] [57427] (10 PDB entries)
  8. 270152Domain d1j8ea_: 1j8e A: [66437]
    seventh module
    complexed with ca; mutant

Details for d1j8ea_

PDB Entry: 1j8e (more details), 1.85 Å

PDB Description: crystal structure of ligand-binding repeat cr7 from lrp

SCOP Domain Sequences for d1j8ea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j8ea_ g.12.1.1 (A:) Ligand-binding domain of low-density lipoprotein receptor {Human (Homo sapiens)}
gshscsstqfkcnsgrcipehwtcdgdndcgdysdethanctnq

SCOP Domain Coordinates for d1j8ea_:

Click to download the PDB-style file with coordinates for d1j8ea_.
(The format of our PDB-style files is described here.)

Timeline for d1j8ea_: