SCOP 1.73: Domain d1j7yb_: 1j7y B:

Lineage for d1j7yb_ (1j7y B:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (4 families)

5. Family a.1.1.2: Globins [46463] (26 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (22 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (173 PDB entries)

8. Domain d1j7yb_: 1j7y B: [66427]
   Other proteins in same PDB: d1j7ya_, d1j7yc_

Details for d1j7yb_

PDB Entry: 1j7y, 1.7 Å

PDB Description: crystal structure of partially ligated mutant of hba

PDB Compounds: (B:) hemoglobin

SCOP Domain Sequences for d1j7yb_:

Sequence; same for both SEQRES and ATOM records:

>d1j7yb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggeaygrllvvypwtqrffesfgdlstpdavmgnpkv
kaqgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d1j7yb_:

• d1j7yb_ first appeared in SCOP 1.59
  
• d1j7yb_ appears in SCOP 1.71
  
• d1j7yb_ appears in SCOP 1.75
  
• d1j7yb_ appears in the current release, SCOPe 2.08