Lineage for d1j7sb_ (1j7s B:)

  1. Root: SCOP 1.59
  2. 93448Class a: All alpha proteins [46456] (151 folds)
  3. 93449Fold a.1: Globin-like [46457] (2 superfamilies)
  4. 93450Superfamily a.1.1: Globin-like [46458] (3 families) (S)
  5. 93460Family a.1.1.2: Globins [46463] (18 proteins)
  6. 93770Protein Hemoglobin, beta-chain [46500] (18 species)
  7. 93817Species Human (Homo sapiens) [TaxId:9606] [46501] (76 PDB entries)
  8. 93908Domain d1j7sb_: 1j7s B: [66418]
    Other proteins in same PDB: d1j7sa_, d1j7sc_

Details for d1j7sb_

PDB Entry: 1j7s (more details), 2.2 Å

PDB Description: crystal structure of deoxy hbalphayq, a mutant of hba

SCOP Domain Sequences for d1j7sb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j7sb_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens)}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnlkgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

SCOP Domain Coordinates for d1j7sb_:

Click to download the PDB-style file with coordinates for d1j7sb_.
(The format of our PDB-style files is described here.)

Timeline for d1j7sb_: