SCOPe 2.03: Domain d1j7sa_: 1j7s A:

Lineage for d1j7sa_ (1j7s A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (23 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (213 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d1j7sa_: 1j7s A: [66417]
   Other proteins in same PDB: d1j7sb_, d1j7sd_
   complexed with hem; mutant

Details for d1j7sa_

PDB Entry: 1j7s, 2.2 Å

PDB Description: crystal structure of deoxy hbalphayq, a mutant of hba

PDB Compounds: (A:) hemoglobin

SCOPe Domain Sequences for d1j7sa_:

Sequence; same for both SEQRES and ATOM records:

>d1j7sa_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaeayermflsfpttktyfphfdlshgsaqvkgqgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyr

Timeline for d1j7sa_:

• d1j7sa_ first appeared in SCOP 1.59
  
• d1j7sa_ appears in SCOPe 2.02
  
• d1j7sa_ appears in SCOPe 2.04
  
• d1j7sa_ appears in the current release, SCOPe 2.08