Class a: All alpha proteins [46456] (290 folds) |
Fold a.39: EF Hand-like [47472] (4 superfamilies) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.39.1: EF-hand [47473] (12 families) Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop |
Family a.39.1.5: Calmodulin-like [47502] (24 proteins) Duplication: made with two pairs of EF-hands |
Protein Calmodulin [47516] (13 species) |
Species Human (Homo sapiens) [TaxId:9606] [47517] (123 PDB entries) Uniprot P02593 |
Domain d1j7pa_: 1j7p A: [66416] C-terminal domain complexed with ca fragment; missing more than one-third of the common structure and/or sequence |
PDB Entry: 1j7p (more details)
SCOPe Domain Sequences for d1j7pa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j7pa_ a.39.1.5 (A:) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} eeeireafrvfdkdgngyisaaelrhvmtnlgekltdeevdemireadidgdgqvnyeef vqmmtak
Timeline for d1j7pa_: