SCOP 1.63: Domain d1j4xa_: 1j4x A:

Lineage for d1j4xa_ (1j4x A:)

1. Root: SCOP 1.63

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432

4. Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families)
   share with the family I the common active site structure with a circularly permuted topology

5. Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins)

6. Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52802] (2 PDB entries)

8. Domain d1j4xa_: 1j4x A: [66392]
   complexed with ahp; mutant
   complexed with phosphopeptide

Details for d1j4xa_

PDB Entry: 1j4x, 2.75 Å

PDB Description: human vh1-related dual-specificity phosphatase c124s mutant-peptide complex

SCOP Domain Sequences for d1j4xa_:

Sequence; same for both SEQRES and ATOM records:

>d1j4xa_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens)}
svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs
fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhsreg
ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp

Timeline for d1j4xa_:

• d1j4xa_ first appeared in SCOP 1.59
  
• d1j4xa_ appears in SCOP 1.61
  
• d1j4xa_ appears in SCOP 1.65
  
• d1j4xa_ appears in the current release, SCOPe 2.08