Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (5 proteins) |
Protein VH1-related dual-specificity phosphatase, VHR [52801] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [52802] (2 PDB entries) |
Domain d1j4xa_: 1j4x A: [66392] complexed with ahp; mutant complexed with phosphopeptide |
PDB Entry: 1j4x (more details), 2.75 Å
SCOP Domain Sequences for d1j4xa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1j4xa_ c.45.1.1 (A:) VH1-related dual-specificity phosphatase, VHR {Human (Homo sapiens)} svqdlndllsdgsgcyslpsqpcnevtpriyvgnasvaqdipklqklgithvlnaaegrs fmhvntnanfykdsgitylgikandtqefnlsayferaadfidqalaqkngrvlvhsreg ysrsptlviaylmmrqkmdvksalsivrqnreigpndgflaqlcqlndrlakegklkp
Timeline for d1j4xa_: