SCOPe 2.02: Domain d1j4rd_: 1j4r D:

Lineage for d1j4rd_ (1j4r D:)

1. Root: SCOPe 2.02

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
   cis-trans prolyl-isomerase

7. Species Human (Homo sapiens) [TaxId:9606] [54537] (41 PDB entries)

8. Domain d1j4rd_: 1j4r D: [66391]
   complexed with 001, gol, so4

Details for d1j4rd_

PDB Entry: 1j4r, 1.8 Å

PDB Description: fk506 binding protein complexed with fkb-001

PDB Compounds: (D:) fk506-binding protein

SCOPe Domain Sequences for d1j4rd_:

Sequence; same for both SEQRES and ATOM records:

>d1j4rd_ d.26.1.1 (D:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

Timeline for d1j4rd_:

• d1j4rd_ first appeared in SCOP 1.59
  
• d1j4rd_ appears in SCOPe 2.01
  
• d1j4rd_ appears in SCOPe 2.03
  
• d1j4rd_ appears in the current release, SCOPe 2.08