Lineage for d1j4rb_ (1j4r B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 857507Fold d.26: FKBP-like [54533] (3 superfamilies)
    core: beta(2)-alpha-beta(2); antiparallel beta-sheet
  4. 857508Superfamily d.26.1: FKBP-like [54534] (3 families) (S)
  5. 857509Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (16 proteins)
  6. 857520Protein FK-506 binding protein (FKBP12), an immunophilin [54536] (2 species)
    cis-trans prolyl-isomerase
  7. 857524Species Human (Homo sapiens) [TaxId:9606] [54537] (33 PDB entries)
  8. 857541Domain d1j4rb_: 1j4r B: [66390]

Details for d1j4rb_

PDB Entry: 1j4r (more details), 1.8 Å

PDB Description: fk506 binding protein complexed with fkb-001
PDB Compounds: (B:) fk506-binding protein

SCOP Domain Sequences for d1j4rb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j4rb_ d.26.1.1 (B:) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]}
gvqvetispgdgrtfpkrgqtcvvhytgmledgkkfdssrdrnkpfkfmlgkqevirgwe
egvaqmsvgqrakltispdyaygatghpgiipphatlvfdvellkle

SCOP Domain Coordinates for d1j4rb_:

Click to download the PDB-style file with coordinates for d1j4rb_.
(The format of our PDB-style files is described here.)

Timeline for d1j4rb_: