SCOPe 2.07: Domain d1j47a1: 1j47 A:2-85

Lineage for d1j47a1 (1j47 A:2-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.21: HMG-box [47094] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.21.1: HMG-box [47095] (2 families)

5. Family a.21.1.1: HMG-box [47096] (10 proteins)

6. Protein SRY [47104] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47105] (5 PDB entries)

8. Domain d1j47a1: 1j47 A:2-85 [66373]
   Other proteins in same PDB: d1j47a2
   protein/DNA complex; mutant

Details for d1j47a1

PDB Entry: 1j47

PDB Description: 3d solution nmr structure of the m9i mutant of the hmg-box domain of the human male sex determining factor sry complexed to dna

PDB Compounds: (A:) sex-determining region y protein

SCOPe Domain Sequences for d1j47a1:

Sequence; same for both SEQRES and ATOM records:

>d1j47a1 a.21.1.1 (A:2-85) SRY {Human (Homo sapiens) [TaxId: 9606]}
qdrvkrpinafivwsrdqrrkmalenprmrnseiskqlgyqwkmlteaekwpffqeaqkl
qamhrekypnykyrprrkakmlpk

Timeline for d1j47a1:

• d1j47a1 first appeared in SCOP 1.59, called d1j47a_
  
• d1j47a1 appears in SCOPe 2.06
  
• d1j47a1 appears in the current release, SCOPe 2.08