SCOPe 2.06: Domain d1itpa1: 1itp A:2-77

Lineage for d1itpa1 (1itp A:2-77)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families)

5. Family d.58.3.2: Subtilase propeptides/inhibitors [54905] (4 proteins)
   decorated with additional structure

6. Protein Proteinase A inhibitor 1, POIA1 [69728] (1 species)

7. Species Oyster mushroom (Pleurotus ostreatus) [TaxId:5322] [69729] (2 PDB entries)

8. Domain d1itpa1: 1itp A:2-77 [66371]
   Other proteins in same PDB: d1itpa2

Details for d1itpa1

PDB Entry: 1itp

PDB Description: solution structure of poia1

PDB Compounds: (A:) proteinase A inhibitor 1

SCOPe Domain Sequences for d1itpa1:

Sequence; same for both SEQRES and ATOM records:

>d1itpa1 d.58.3.2 (A:2-77) Proteinase A inhibitor 1, POIA1 {Oyster mushroom (Pleurotus ostreatus) [TaxId: 5322]}
sagkfivifkndvsedkiretkdeviaeggtitneynmpgmkgfageltpqsltkfqglq
gdlidsieedgivttq

Timeline for d1itpa1:

• d1itpa1 first appeared in SCOP 1.59, called d1itpa_
  
• d1itpa1 was called d1itpa_ in SCOPe 2.05
  
• d1itpa1 appears in SCOPe 2.07
  
• d1itpa1 appears in the current release, SCOPe 2.08