Lineage for d1iszb1 (1isz B:813-936)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 111051Fold b.42: beta-Trefoil [50352] (5 superfamilies)
  4. 111186Superfamily b.42.2: Ricin B-like lectins [50370] (2 families) (S)
  5. 111187Family b.42.2.1: Ricin B-like [50371] (2 proteins)
  6. 111188Protein Endo-1,4-beta-xylanase C-terminal domain [50377] (1 species)
  7. 111189Species Streptomyces olivaceoviridis [TaxId:1921] [50378] (7 PDB entries)
  8. 111193Domain d1iszb1: 1isz B:813-936 [66359]
    Other proteins in same PDB: d1isza2, d1iszb2

Details for d1iszb1

PDB Entry: 1isz (more details), 2 Å

PDB Description: crystal structure of xylanase from streptomyces olivaceoviridis e-86 complexed with galactose

SCOP Domain Sequences for d1iszb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iszb1 b.42.2.1 (B:813-936) Endo-1,4-beta-xylanase C-terminal domain {Streptomyces olivaceoviridis}
gqikgvgsgrcldvpnasttdgtqvqlydchsatnqqwtytdagelrvygdkcldaagtg
ngtkvqiyscwggdnqkwrlnsdgsivgvqsglcldavgggtangtliqlyscsngsnqr
wtrt

SCOP Domain Coordinates for d1iszb1:

Click to download the PDB-style file with coordinates for d1iszb1.
(The format of our PDB-style files is described here.)

Timeline for d1iszb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iszb2