Lineage for d1irqb_ (1irq B:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 281399Fold a.43: Met repressor-like [47597] (1 superfamily)
    core: 4 helices; array of 2 hairpins, opened
  4. 281400Superfamily a.43.1: Met repressor-like [47598] (2 families) (S)
    dimeric proteins; the N-termini form a small beta-sheet
  5. 281442Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins)
  6. 281475Protein Omega transcriptional repressor [69031] (1 species)
    plasmid-encoded, similar to the phage repressor family
  7. 281476Species Streptococcus pyogenes [TaxId:1314] [69032] (1 PDB entry)
  8. 281478Domain d1irqb_: 1irq B: [66298]

Details for d1irqb_

PDB Entry: 1irq (more details), 1.5 Å

PDB Description: Crystal structure of omega transcriptional repressor at 1.5A resolution

SCOP Domain Sequences for d1irqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irqb_ a.43.1.2 (B:) Omega transcriptional repressor {Streptococcus pyogenes}
dimgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl

SCOP Domain Coordinates for d1irqb_:

Click to download the PDB-style file with coordinates for d1irqb_.
(The format of our PDB-style files is described here.)

Timeline for d1irqb_:

281478
d1irqb_ in context of PDB
View in 3D
Domains from other chains:
(mouse over for more information)
d1irqa_