Class a: All alpha proteins [46456] (179 folds) |
Fold a.43: Met repressor-like [47597] (1 superfamily) core: 4 helices; array of 2 hairpins, opened |
Superfamily a.43.1: Met repressor-like [47598] (2 families) dimeric proteins; the N-termini form a small beta-sheet |
Family a.43.1.2: CopG/MetJ-like bacterial repressors [47604] (3 proteins) |
Protein Omega transcriptional repressor [69031] (1 species) plasmid-encoded, similar to the phage repressor family |
Species Streptococcus pyogenes [TaxId:1314] [69032] (1 PDB entry) |
Domain d1irqa_: 1irq A: [66297] |
PDB Entry: 1irq (more details), 1.5 Å
SCOP Domain Sequences for d1irqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1irqa_ a.43.1.2 (A:) Omega transcriptional repressor {Streptococcus pyogenes} imgdktvrvradlhhiikietaknggnvkevmdqaleeyirkylpdkl
Timeline for d1irqa_: