Lineage for d1iqwl2 (1iqw L:112-215)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 103722Species Anti-human Fas Fab hfe7a, (mouse), kappa L chain [69154] (1 PDB entry)
  8. 103724Domain d1iqwl2: 1iqw L:112-215 [66280]
    Other proteins in same PDB: d1iqwh1, d1iqwl1

Details for d1iqwl2

PDB Entry: 1iqw (more details), 2.5 Å

PDB Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a

SCOP Domain Sequences for d1iqwl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqwl2 b.1.1.2 (L:112-215) Immunoglobulin (constant domains of L and H chains) {Anti-human Fas Fab hfe7a, (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1iqwl2:

Click to download the PDB-style file with coordinates for d1iqwl2.
(The format of our PDB-style files is described here.)

Timeline for d1iqwl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqwl1