Lineage for d1iqwl1 (1iqw L:1-111)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1288590Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1289056Species Mouse (Mus musculus), cluster 2 [TaxId:10090] [88526] (30 PDB entries)
  8. 1289065Domain d1iqwl1: 1iqw L:1-111 [66279]
    Other proteins in same PDB: d1iqwh1, d1iqwh2, d1iqwl2
    part of anti-human Fas Fab HFE7a

Details for d1iqwl1

PDB Entry: 1iqw (more details), 2.5 Å

PDB Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a
PDB Compounds: (L:) antibody m-hfe7a, light chain

SCOPe Domain Sequences for d1iqwl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqwl1 b.1.1.1 (L:1-111) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 2 [TaxId: 10090]}
divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles
giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleik

SCOPe Domain Coordinates for d1iqwl1:

Click to download the PDB-style file with coordinates for d1iqwl1.
(The format of our PDB-style files is described here.)

Timeline for d1iqwl1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqwl2