![]() | Class b: All beta proteins [48724] (110 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species) |
![]() | Species Anti-human Fas Fab hfe7a, (mouse), kappa L chain [69144] (1 PDB entry) |
![]() | Domain d1iqwl1: 1iqw L:1-111 [66279] Other proteins in same PDB: d1iqwh2, d1iqwl2 |
PDB Entry: 1iqw (more details), 2.5 Å
SCOP Domain Sequences for d1iqwl1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iqwl1 b.1.1.1 (L:1-111) Immunoglobulin (variable domains of L and H chains) {Anti-human Fas Fab hfe7a, (mouse), kappa L chain} divltqspaslavslgqratisckasqsvdydgdsymnwyqqkpgqppklliyaasnles giparfsgsgsgtdftlnihpveeedaatyycqqsnedprtfgggtkleik
Timeline for d1iqwl1: