Lineage for d1iqwh1 (1iqw H:1-121)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102094Species Anti-human Fas Fab hfe7a, (mouse), kappa L chain [69144] (1 PDB entry)
  8. 102095Domain d1iqwh1: 1iqw H:1-121 [66277]
    Other proteins in same PDB: d1iqwh2, d1iqwl2

Details for d1iqwh1

PDB Entry: 1iqw (more details), 2.5 Å

PDB Description: crystal structure of the fab fragment of the mouse anti-human fas antibody hfe7a

SCOP Domain Sequences for d1iqwh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqwh1 b.1.1.1 (H:1-121) Immunoglobulin (variable domains of L and H chains) {Anti-human Fas Fab hfe7a, (mouse), kappa L chain}
qvqlqqpgaelvkpgasvklsckasgytftsywmqwvkqrpgqglewigeidpsdsytny
nqkfkgkatltvdtssstaymqlssltsedsavyycarnrdysnnwyfdvwgtgttvtvs
s

SCOP Domain Coordinates for d1iqwh1:

Click to download the PDB-style file with coordinates for d1iqwh1.
(The format of our PDB-style files is described here.)

Timeline for d1iqwh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iqwh2