Lineage for d1iqcc2 (1iqc C:151-308)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1719636Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 1719637Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 1720225Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
    duplication: contains two cytochrome c-type domains
  6. 1720226Protein Di-heme cytochrome c peroxidase [46686] (3 species)
  7. 1720227Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)
  8. 1720233Domain d1iqcc2: 1iqc C:151-308 [66271]
    complexed with ca, gol, hem, mg

Details for d1iqcc2

PDB Entry: 1iqc (more details), 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea
PDB Compounds: (C:) di-heme peroxidase

SCOPe Domain Sequences for d1iqcc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iqcc2 a.3.1.5 (C:151-308) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]}
tpgskfdkwlegdknalnqdelegynlfkgsgcvqchngpavggssyqkmgvfkpyetkn
paagrmdvtgneadrnvfkvptlrnieltypyfhdggaatleqavetmgriqlnrefnkd
evskivaflktltgdqpdfklpilppsnndtprsqpye

SCOPe Domain Coordinates for d1iqcc2:

Click to download the PDB-style file with coordinates for d1iqcc2.
(The format of our PDB-style files is described here.)

Timeline for d1iqcc2: