SCOPe 2.08: Domain d1iqcc2: 1iqc C:151-308

Lineage for d1iqcc2 (1iqc C:151-308)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.5: Di-heme cytochrome c peroxidase [46685] (1 protein)
   duplication: contains two cytochrome c-type domains

6. Protein Di-heme cytochrome c peroxidase [46686] (3 species)

7. Species Nitrosomonas europaea [TaxId:915] [68955] (1 PDB entry)

8. Domain d1iqcc2: 1iqc C:151-308 [66271]
   complexed with ca, gol, hec, mg

Details for d1iqcc2

PDB Entry: 1iqc, 1.8 Å

PDB Description: crystal structure of di-heme peroxidase from nitrosomonas europaea

PDB Compounds: (C:) di-heme peroxidase

SCOPe Domain Sequences for d1iqcc2:

Sequence; same for both SEQRES and ATOM records:

>d1iqcc2 a.3.1.5 (C:151-308) Di-heme cytochrome c peroxidase {Nitrosomonas europaea [TaxId: 915]}
tpgskfdkwlegdknalnqdelegynlfkgsgcvqchngpavggssyqkmgvfkpyetkn
paagrmdvtgneadrnvfkvptlrnieltypyfhdggaatleqavetmgriqlnrefnkd
evskivaflktltgdqpdfklpilppsnndtprsqpye

Timeline for d1iqcc2:

• d1iqcc2 first appeared in SCOP 1.59
  
• d1iqcc2 appears in SCOPe 2.07